PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009788365.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 249aa    MW: 27734.9 Da    PI: 6.4906
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009788365.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.81.2e-3847108263
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                     k++al+cprC+stntkfCyynnyslsqPryfCk+C+ryWt+GG+lr +P+Ggg+rk+kksss
  XP_009788365.1  47 KDQALNCPRCNSTNTKFCYYNNYSLSQPRYFCKTCKRYWTEGGSLRSIPIGGGSRKSKKSSS 108
                     7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-243496IPR003851Zinc finger, Dof-type
PfamPF027011.2E-3348105IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.40751105IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105389IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MDTAQWPQEI VVKPMEEIIP KNTNTITTIC SSKPSTHIER KIRPHQKDQA LNCPRCNSTN  60
TKFCYYNNYS LSQPRYFCKT CKRYWTEGGS LRSIPIGGGS RKSKKSSSTN CSSSNTVLRE  120
FSKNVVAPVL DPPKMEGSQD LNLGFSCDFK TISELIQVPN NSFMPMPISD PNSVYSSLNF  180
SLDYGLGISG DYENNLQDVQ DSTTSGRLLF PFEDLKQISN TSIDCAEENR DGESNGYWNA  240
VLGGNGGSW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB9717090.0AB971709.1 Nicotiana tabacum NtBBF2 mRNA for Dof zinc finger protein, complete cds, cultivar: Samsun NN.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009788365.10.0PREDICTED: dof zinc finger protein DOF1.8-like
RefseqXP_016478543.10.0PREDICTED: dof zinc finger protein DOF1.8-like
SwissprotQ8LAP81e-50DOF46_ARATH; Dof zinc finger protein DOF4.6
TrEMBLA0A0B6VI930.0A0A0B6VI93_TOBAC; Dof zinc finger protein
STRINGVIT_02s0025g02250.t012e-78(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64620.16e-42Dof family protein